forked from OpenMS/OpenMS
-
Notifications
You must be signed in to change notification settings - Fork 5
Commit
This commit does not belong to any branch on this repository, and may belong to a fork outside of the repository.
* reading of version numbers * scaffold for PercolatorInfile::load * nop * minimal parsing * wip * more entries * nop * Update PercolatorInfile.cpp * add modification parsing to pin file * use proper score column for main score * Update src/openms/include/OpenMS/FORMAT/PercolatorInfile.h * creates basic test file * update test * update test * update pin file parsing * Apply suggestions from code review * some minor work on adapter * support multi file pin files * nop * improved sage support * improved sage support * support for multiple files * add sage subscores for percolator / mokapot rescoring * support for subscores propagation to percolator * some preparation to for config template * wrap easy parameters * change map_inde to id_merge_index, add enzyme support * untested support for all relevant parameters * small refactoring * first working version * Update src/topp/SageAdapter.cpp * Apply suggestions from code review Co-authored-by: Julianus Pfeuffer <pfeuffer@informatik.uni-tuebingen.de> * expand search meta data * prepration for thirdparty test * removed unneded copy * fix some missing update error * add precursor RT and MZ to id results * fix wrong paramter in test. good test data still WIP * add Sage test * mend * Update src/topp/SageAdapter.cpp * update test filename in idXML * Update third_party_tests.cmake --------- Co-authored-by: timosachsenberg <sachsenb@ibminode02.Cs.Uni-Tuebingen.De> Co-authored-by: timosachsenberg <sachsenb@ibminode04.cs.uni-tuebingen.de> Co-authored-by: Samuel Wein <sam@samwein.com> Co-authored-by: Julianus Pfeuffer <pfeuffer@informatik.uni-tuebingen.de>
- Loading branch information
1 parent
69a0ee6
commit ef37a65
Showing
16 changed files
with
965 additions
and
12 deletions.
There are no files selected for viewing
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Submodule pyopenms-docs
updated
2 files
+1 −0 | docs/source/user_guide/index.rst | |
+22 −0 | docs/source/user_guide/logging.rst |
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
Original file line number | Diff line number | Diff line change |
---|---|---|
@@ -0,0 +1,8 @@ | ||
>sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2 | ||
MSDEREVAEAATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYD | ||
KVKLQSRPAAPPAPGPGQLTLRLRACGLNFADLMARQGLYDRLPPLPVTPGMEGAGVVIA | ||
VGEGVSDRKAGDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVL | ||
FDFGNLQPGHSVLVHMAAGGVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDY | ||
HTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA | ||
LARTWWNQFSVTALQLLQANRAVCGFHLGYLDGEVELVSGVVARLLALYNQGHIKPHIDS | ||
VWPFEKVADAMKQMQEKKNVGKVLLVPGPEKEN |
Large diffs are not rendered by default.
Oops, something went wrong.
Oops, something went wrong.